Skip to main content
AllMCPs
BrowseBestCategoriesStackCompareToolsGuidesBlog
Log in Submit MCP

Stay in the loop

Get new MCP servers and top picks in your inbox.

AllMCPs

The open directory for discovering and installing Model Context Protocol servers.

AllMCPs on GitHub (opens in a new tab)
Launched onTiny Startupstinystartups.com
Explore
  • Browse servers
  • Best MCP servers
  • Categories
  • MCP clients
  • Agent prompts
  • Stack Builder
  • Compare servers
  • Random discovery New
  • Submit a server
  • Pricing & Boost Boost
Learn
  • Guides hub
  • What is MCP?
  • Install guide
  • Build an MCP server
  • Deploy an MCP server
  • Security guide
  • Troubleshooting
  • MCP for SEO & AEO
  • Protocol versioning
  • Blog & updates
Tools
  • All developer tools
  • Config generator
  • Config validator
  • Config auditor
  • MCP playground
  • Token calculator
  • OpenAPI β†’ MCP
  • Badge generator
For agents
  • REST API docs
  • Trust & traffic Live
  • Remote MCP server SSE β†— (opens in a new tab)
  • llms.txt β†— (opens in a new tab)
  • Catalog JSON β†— (opens in a new tab)
Company
  • About
  • Advertise Sponsor
  • Contact
  • GitHub β†— (opens in a new tab)
  • Terms
  • Privacy
AllMCPs VerifiedAllMCPs VerifiedFeatured on Nick LaunchesFeatured on Nick LaunchesLaunch Llama NewsletterLaunch Llama NewsletterVerified DR - allmcps.comVerified DR - allmcps.comFeatured on SaaSGrowFeatured on SaaSGrowFeatured on Twelve ToolsFeatured on Twelve ToolsFeatured on Saaspa.geFeatured on Saaspa.geFeatured on Findly.toolsFeatured on Findly.toolsFeatured on Startup FameFeatured on Startup FameFeatured on LaunchKiwiFeatured on LaunchKiwiFeatured on ScrollLaunchFeatured on ScrollLaunchFeatured on DailyPingsFeatured on DailyPingsFazier badgeFazier badgeFeatured on NewTool.siteFeatured on NewTool.siteFeatured on saasfame.comFeatured on saasfame.comDR Checker - Domain RatingDR Checker - Domain RatingListed on Turbo0Listed on Turbo0Launched on LaunchBoard - Product Launch PlatformLaunched on LaunchBoard - Product Launch PlatformList on SimilarlabsList on Similarlabshttps://codetrendy.comhttps://codetrendy.comListed on DevTool.ioFeatured on BuildlistFeatured on BuildlistLaunched on Tiny StartupsFeatured on ShowMeBestAIFeatured on ShowMeBestAIFind us on LaunchZoneFind us on LaunchZoneAllMCPs VerifiedAllMCPs VerifiedFeatured on Nick LaunchesFeatured on Nick LaunchesLaunch Llama NewsletterLaunch Llama NewsletterVerified DR - allmcps.comVerified DR - allmcps.comFeatured on SaaSGrowFeatured on SaaSGrowFeatured on Twelve ToolsFeatured on Twelve ToolsFeatured on Saaspa.geFeatured on Saaspa.geFeatured on Findly.toolsFeatured on Findly.toolsFeatured on Startup FameFeatured on Startup FameFeatured on LaunchKiwiFeatured on LaunchKiwiFeatured on ScrollLaunchFeatured on ScrollLaunchFeatured on DailyPingsFeatured on DailyPingsFazier badgeFazier badgeFeatured on NewTool.siteFeatured on NewTool.siteFeatured on saasfame.comFeatured on saasfame.comDR Checker - Domain RatingDR Checker - Domain RatingListed on Turbo0Listed on Turbo0Launched on LaunchBoard - Product Launch PlatformLaunched on LaunchBoard - Product Launch PlatformList on SimilarlabsList on Similarlabshttps://codetrendy.comhttps://codetrendy.comListed on DevTool.ioFeatured on BuildlistFeatured on BuildlistLaunched on Tiny StartupsFeatured on ShowMeBestAIFeatured on ShowMeBestAIFind us on LaunchZoneFind us on LaunchZone
Β© 2026 Jackalope Digital LLC. All rights reserved.
  1. Home
  2. πŸš† Travel & Transportation
  3. MCP Teslamate Fleet
MCP Teslamate Fleet logo
Health: ActiveRecent health check succeeded.Last checked 9/9/2026, 8:31:49 PM

MCP Teslamate Fleet

User RatingsBe the first to rate and review this MCP server!
View Repository2 GitHub StarsTotal stargazers on GitHub for the source repository (2 stars).Visit Website
teslateslamatevehicle-telemetryfleet-apiremote-control

Combines TeslaMate analytics with Tesla Fleet API live data and remote vehicle commands.

Quick Install

Automated & IDE Setup

Copy the AI prompt to install this server into Claude Code, Cursor, or another agent β€” or use 1-click editor setup below.

Add to CursorAdd to VS Code
Not yet automatically verified

We haven't yet run this listing's install command through our automated sandbox check. This isn't a red flag β€” we're steadily working through the catalog.

Manual Client & Custom JSON ConfigExpand JSON β–Ύ

Client Config & Setup

Choose your client or environment
Target File:~/Library/Application Support/Claude/claude_desktop_config.json
claude_desktop_config.json
{
  "mcpServers": {
    "lodordev-mcp-teslamate-fleet": {
      "command": "uvx",
      "args": [
        "--from",
        "git+https://github.com/lodordev/mcp-teslamate-fleet",
        "mcp-teslamate-fleet"
      ]
    }
  }
}

πŸ’‘ Paste the JSON block into your client's configuration file under mcpServers, then restart the application.

Install Directory Badge Claim listing AlternativesπŸš† More in Travel & Transportation

Overview

This MCP server exposes TeslaMate driving, charging, vehicle-state, and energy analytics alongside Fleet API live data and commands. Use it with a TeslaMate Postgres database, Fleet API credentials, or both. Fleet API commands require a Tesla HTTP proxy, while live data only requires a token.

Use cases

β€’Analyze driving and charging history
β€’Track battery health and energy efficiency
β€’Compare charging costs with gasoline costs
β€’Check live vehicle data
β€’Control climate, charging, locks, and sentry mode

Key features

β€’29 tools across TeslaMate and Fleet API backends
β€’Driving, charging, location, and vehicle-state history
β€’Energy, efficiency, savings, and trip-cost analytics
β€’Live Tesla vehicle data
β€’Remote climate, charging, lock, trunk, horn, light, and sentry commands
β€’Confirmation required for unlock and trunk commands

Capabilities & Tool Schemas

Inspect callable tools, capabilities, and parameters exposed to AI agents by MCP Teslamate Fleet.

Extracted Tool Capabilities
29 tools across TeslaMate and Fleet API backends
Driving, charging, location, and vehicle-state history
Energy, efficiency, savings, and trip-cost analytics
Live Tesla vehicle data
Remote climate, charging, lock, trunk, horn, light, and sentry commands
Confirmation required for unlock and trunk commands

Documentation Overview

TeslaMate + Fleet API MCP Server

mcp-teslamate-fleet MCP server

MCP server combining TeslaMate historical analytics with Fleet API live data and commands. Works with Claude Code, Claude Desktop, Cursor, and any MCP-compatible client.

The first MCP server to bring both data sources together β€” use TeslaMate for deep analytics and Fleet API for real-time control, or configure just one.

Features

29 tools across four categories:

CategoryToolsBackend
Status & Historytesla_status, tesla_drives, tesla_charging_history, tesla_battery_health, tesla_efficiency, tesla_location_history, tesla_state_history, tesla_software_updatesTeslaMate
Analyticstesla_savings, tesla_trip_cost, tesla_efficiency_by_temp, tesla_charging_by_location, tesla_top_destinations, tesla_longest_trips, tesla_monthly_summary, tesla_vampire_drainTeslaMate
Live Datatesla_liveFleet API
Commandstesla_climate_on/off, tesla_set_temp, tesla_charge_start/stop, tesla_set_charge_limit, tesla_lock, tesla_unlock, tesla_honk, tesla_flash, tesla_trunk, tesla_sentryFleet API

Safety: unlock and trunk commands require confirm=True. All commands are rate-limited to 40/day.

Quick Start

Claude Code (.mcp.json)

config.json
{
  "mcpServers": {
    "tesla": {
      "command": "uvx",
      "args": ["--from", "git+https://github.com/lodordev/mcp-teslamate-fleet", "mcp-teslamate-fleet"],
      "env": {
        "TESLAMATE_DB_HOST": "localhost",
        "TESLAMATE_DB_PASS": "your_password",
        "TESLA_VIN": "your_vin",
        "TESLA_TOKEN_FILE": "/path/to/tokens.json",
        "TESLA_CLIENT_ID": "your_client_id",
        "TESLA_CLIENT_SECRET": "your_client_secret",
        "TESLA_PROXY_URL": "https://localhost:4443",
        "TESLA_VERIFY_SSL": "false"
      }
    }
  }
}

Claude Desktop (claude_desktop_config.json)

Same structure β€” add under mcpServers.

Local install

bash
git clone https://github.com/lodordev/mcp-teslamate-fleet
cd tesla-mcp
pip install -e .

Prerequisites

You need at least one of these backends configured. Both is ideal.

TeslaMate (analytics + history)

TeslaMate is an open-source Tesla data logger. It records driving, charging, and vehicle state to a Postgres database.

If you already run TeslaMate, you just need the database connection details. If not, see the TeslaMate installation guide.

Fleet API (live data + commands)

Tesla's Fleet API provides real-time vehicle data and remote commands. Setup requires:

  1. Register an app at developer.tesla.com
  2. Generate OAuth tokens β€” use Tesla's token generation flow
  3. Set up the HTTP proxy β€” commands must be signed using the Tesla Vehicle Command Protocol. Deploy the tesla-http-proxy from that repo

The proxy is only needed for commands (tesla_climate_on, tesla_lock, etc.). tesla_live works with just a token.

Tesla provides a $10/month free credit for Fleet API, which is more than enough for personal MCP use.

Configuration

All configuration is via environment variables.

TeslaMate Database

VariableDefaultDescription
TESLAMATE_DB_HOST(required)Postgres host
TESLAMATE_DB_PORT5432Postgres port
TESLAMATE_DB_USERteslamatePostgres user
TESLAMATE_DB_PASS(required)Postgres password
TESLAMATE_DB_NAMEteslamateDatabase name

Fleet API

VariableDefaultDescription
TESLA_VIN(required)Vehicle VIN
TESLA_TOKEN_FILE(required)Path to tokens.json with OAuth tokens
TESLA_CLIENT_IDFleet API client ID (for token refresh)
TESLA_CLIENT_SECRETFleet API client secret (for token refresh)
TESLA_PROXY_URLHTTP proxy URL for commands
TESLA_FLEET_URLNA regionFleet API endpoint (regional options)
TESLA_VERIFY_SSLtrueSet false for self-signed proxy certs

Vehicle Configuration

VariableDefaultDescription
TESLA_CAR_ID1TeslaMate car ID (for multi-car instances)
TESLA_BATTERY_KWH75Usable battery capacity in kWh
TESLA_BATTERY_RANGE_KM525EPA range at 100% in km

Energy consumption is estimated from ideal range deltas using these values. Adjust for your vehicle:

VehicleBattery (kWh)Range (km)
Model 3 Standard Range54350
Model 3 Long Range75500
Model Y Long Range75525
Model S Long Range100650
Model X Long Range100560

Cost Defaults

These are defaults β€” tesla_savings and tesla_trip_cost accept per-call overrides.

VariableDefaultDescription
TESLA_ELECTRICITY_RATE0.12Electricity cost in $/kWh
TESLA_GAS_PRICE3.50Gas price in $/gallon (for comparison)
TESLA_GAS_MPG28Comparable gas vehicle MPG

Architecture

Single-file Python server (~1400 lines) using FastMCP. Two data paths:

Code
β”Œβ”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”     β”Œβ”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”
β”‚  TeslaMate   │────▢│   Postgres   │──┐
β”‚  (logger)    β”‚     β”‚  (telemetry) β”‚  β”‚
β””β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”˜     β””β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”˜  β”‚   β”Œβ”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”     β”Œβ”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”
                                       β”œβ”€β”€β–Άβ”‚ tesla.py  │────▢│ MCP Client β”‚
β”Œβ”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”     β”Œβ”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”  β”‚   β”‚ (server)  β”‚     β”‚ (Claude,   β”‚
β”‚  Tesla       │────▢│ HTTP Proxy   β”‚β”€β”€β”˜   β””β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”˜     β”‚  Cursor)   β”‚
β”‚  Fleet API   β”‚     β”‚ (commands)   β”‚                         β””β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”˜
β””β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”˜     β””β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”€β”˜

Limitations

  • Single vehicle β€” queries use a configurable car_id but tools don't accept it as a parameter. Multi-car users should run separate server instances.
  • Imperial units β€” output is in miles, Β°F, and PSI. Metric support is planned.
  • Estimated kWh β€” TeslaMate's drives table doesn't include energy consumed directly. We estimate from ideal range deltas using your configured battery capacity. Accuracy is ~90-95%.

Credits

Inspired by cobanov/teslamate-mcp. Built with FastMCP and TeslaMate.

License

MIT

Read the full README β†’View source on GitHub β†’

Related MCP Servers

View all in Travel & Transportation View all alternatives
  • Teslamate MCP logoTeslamate MCP

    A Model Context Protocol (MCP) server that provides access to your TeslaMate database, allowing AI assistants to query Tesla vehicle data and analytics.

    πŸš† Travel & Transportation4 views
    Compare vs Teslamate MCP β†’
  • Timetable API Node logoTimetable API Node

    Real-time Lviv (Ukraine) public transport: stop arrivals, live vehicle positions, route geometry, and nearby stop discovery. No API key required.

    πŸš† Travel & Transportation2 views
    Compare vs Timetable API Node β†’
  • BoostedTravel logoBoostedTravel

    Flight search & booking for AI agents. 400+ airlines, $20-50 cheaper than OTAs.

    πŸš† Travel & Transportation3 views
    Compare vs BoostedTravel β†’
  • MCP Server Airbnb logoMCP Server Airbnb

    Provides tools to search Airbnb and get listing details.

    πŸš† Travel & Transportation3 views
    Compare vs MCP Server Airbnb β†’

Adoption & maintenance

Factual signals from GitHub, npm, and our automated checks β€” not a rating.

GitHub stars
2
Stargazers on the source repository.
Last commit
5mo ago
Most recent push to the default branch.
Directory activity
1 views
Config copies, upvotes, and views on AllMCPs.

Reviews

No reviews yet β€” be the first to share how this listing worked for you.

Frequently Asked Questions about MCP Teslamate Fleet

It uses TeslaMate's Postgres database for historical analytics and Tesla's Fleet API for live data and remote commands.

AllMCPs Directory Badge

Full Badge Customizer

Showcase your server listing on GitHub or your project documentation. Embed this dynamic SVG badge to highlight official listing status and live engagement.

Badge Style:
Live Dynamic SVG PreviewMCP Teslamate Fleet AllMCPs Directory Badge
Markdown (GitHub README)
[![AllMCPs](https://allmcps.com/api/badge/lodordev-mcp-teslamate-fleet?style=directory)](https://allmcps.com/mcp/lodordev-mcp-teslamate-fleet)
HTML Embed
<a href="https://allmcps.com/mcp/lodordev-mcp-teslamate-fleet"><img src="https://allmcps.com/api/badge/lodordev-mcp-teslamate-fleet?style=directory" alt="MCP Teslamate Fleet on AllMCPs" /></a>

Technical Specs & Signals

CategoryπŸš†Travel & Transportation
PricingFree
More technical detailsExpand β–Ύ
TransportSTDIO
RuntimePython
AuthOAuth
ClientsClaude Desktop, Cursor
Last updatedAug 9, 2026
11/11 checks healthy over the last 33d
Views1
Unique ViewsTotal visits recorded for this listing page on AllMCPs.
Installs0
Installs & Copy ActionsTotal times users copied install commands or configuration snippets for this server.
GitHub stars2
GitHub Star CountTotal stargazers on GitHub representing community popularity (2 stars).
Last commit5mo ago
Last Repository CommitThe most recent commit or push recorded for this server's GitHub repository.Last commit on Mar 23, 2026
47Quality signal: Fair Β· 47/100How this signal is calculated β–Ύ
Server availabilityNot measured

Not scored for repo-hosted servers β€” we can't reach the running server, only its GitHub page. Hosted MCP endpoints are health-checked live.

Verified ownership10/20
Documentation & tools23/30
Adoption & activity2/15
Community engagement0/10

A guidance signal from public completeness & health data β€” not a user rating. New listings start lower and rise as they add docs, get verified, and grow adoption. Signals we can't observe for a listing are skipped, not counted against it.

Supply-chain signal

No high-severity advisories surfaced by our automated scan.

Critical 0High 0Medium 0Low 0

Scanned 27d ago via OSV.dev Β· mcp-teslamate-fleet (PyPI)

β˜… FeaturedAllMCPs Server logo

AllMCPs Server

The official MCP server for AllMCPs.com - submit and manage tools directly from your AI. The open directory for MCP servers. Connect Claude, Cursor, Windsurf, and AI agents to databases, tools, files, and APIs. Explore 10,000+ servers. AllMCPs is the premier, open directory for discovering, evaluating, and installing Model Context Protocol (MCP) servers to equip AI agents and LLMs with real-world superpowers.

Explore Server β†’

Own this project?

This directory is pre-filled from public sources. Claim via GitHub README, site badge, or DNS TXT to unlock edit access and the Official badge β€” proof is checked automatically, then reviewed by our team.

Free dofollow backlink: add your website and place the AllMCPs badge on it β€” no claim needed. We detect it automatically and keep it verified as long as the badge stays live.

Claim & get free dofollow

Share & Embed

Add our SVG badge (dark/light directory styles) or embeddable widget to your site.

Explore more

More in πŸš† Travel & Transportation β†’Best MCP servers for Travel & Transportation β†’Alternatives to MCP Teslamate Fleet β†’Install in Claude DesktopInstall in CursorInstall in VS Code